General Information

  • ID:  hor006530
  • Uniprot ID:  P10354
  • Protein name:  Pancreastatin
  • Gene name:  Chga
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  Animal
  • Expression:  Expressed in the brain and adrenal and pituitary glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding
  • GO BP:  GO:0001934 positive regulation of protein phosphorylation; GO:0002026 regulation of the force of heart contraction; GO:0002551 mast cell chemotaxis; GO:0033366 protein localization to secretory granule; GO:0033604 negative regulation of catecholamine secretion; GO:0042698 ovulation cycle; GO:0042742 defense response to bacterium; GO:0043303 mast cell degranulation; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045576 mast cell activation; GO:0045907 positive regulation of vasoconstriction; GO:0046676 negative regulation of insulin secretion; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0051480 regulation of cytosolic calcium ion concentration; GO:0060452 positive regulation of cardiac muscle contraction; GO:0086030 adenylate cyclase-activating adrenergic receptor signaling pathway involved in cardiac muscle relaxation; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1901899 positive regulation of relaxation of cardiac muscle; GO:2000707 positive regulation of dense core granule biogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030133 transport vesicle; GO:0030141 secretory granule; GO:0031410 cytoplasmic vesicle; GO:0042583 chromaffin granule; GO:0048471 perinuclear region of cytoplasm; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  DDDGQSESQAVNGKTGASEAVPSEGKGELEHSQQEEDGEEAMAGPPQGLFPG
  • Length:  52(281-332)
  • Propeptide:  MRSSAALALLLCAGQVFALPVNSPMTKGDTKVMKCVLEVISDSLSKPSPMPVSPECLETLQGDERVLSILRHQNLLKELQDLALQGAKERAQQQQQQQQQQQQQQQQQQQQHSSFEDELSEVFENQSPAAKHGDAASEAPSKDTVEKREDSDKGQQDAFEGTTEGPRPQAFPEPKQESSMMGNSQSPGEDTANNTQSPTSLPSQEHGIPQTTEGSERGPSAQQQARKAKQEEKEEEEEEKEEEEEEKEEKAIARE
  • Signal peptide:  MRSSAALALLLCAGQVFA
  • Modification:  T8 Phosphoserine;T32 Phosphoserine;T52 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Pancreastatin]: Strongly inhibits glucose induced insulin release from the pancreas.; Catestatin inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist. Can induce ma
  • Mechanism:  Binds calcium with a low-affinity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10354-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006530_AF2.pdbhor006530_ESM.pdb

Physical Information

Mass: 619530 Formula: C216H332N62O91S
Absent amino acids: CIRWY Common amino acids: EG
pI: 3.6 Basic residues: 3
Polar residues: 16 Hydrophobic residues: 10
Hydrophobicity: -120.19 Boman Index: -12508
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 35.77
Instability Index: 6961.92 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2828116
  • Title:  Primary structure of rat chromogranin A and distribution of its mRNA.
  • PubMed ID:  3044825
  • Title:  The molecular cloning of the chromogranin A-like precursor of beta-granin and pancreastatin from the endocrine pancreas.
  • PubMed ID:  3896848
  • Title:  beta-Granins: 21 kDa co-secreted peptides of the insulin granu
  • PubMed ID:  12388744
  • Title:  
  • PubMed ID:  14597614
  • Title:  
  • PubMed ID:  22459152
  • Title:  
  • PubMed ID:  22673903
  • Title:  
  • PubMed ID:  29166604
  • Title: